Yeast - Actin and actin-related proteins multiple alignment

mips


See Poch O.and Winsor B.
Whos Who among the saccharomyces cerevisi aeactin-related proteins - a classification and nomenclature proposal for a large family
Yeast 13: 1053-1058 (1997)

1 10 20 30 40 50 60 70 80 90 100 Position 8 13 16 21 29 35 Sec Struct bbbbbb bbbbbb bbbb bbbb Acts_Human (1) ........MCDED.ETTALVCDNGSGLVKAGFAGDDA..PRAVFPSI.VGRPRHQGVMV......................................... Act4_drome (2) ........MCDE..EASALVVDNGSGMCKAGFAGDDA..PRAVFPSI.VGRPRHQGVMV......................................... Acta_Limpo (3) ........MCDE..DVAALVVDNGSGMCKAGFAGDDA..PRAVFPSI.VGRPRHQGVMV......................................... Actb_Xenbo (4) ........MADD..DIAALVIDNGSGMCKAGFAGDDA..PRAVFPSI.VGRPRHQGVMV......................................... Actm_Aplca (5) ........MCDD..EVAALVVDNGSGMCKAGFAGDDA..PRAVFPSI.VGRPRHQGVMV......................................... Act1_Podca (6) ........MADD..DVAALVVDNGSGMCKAGFAGDDA..PRAVFPSI.VGRPRHQGVMV......................................... Act3_Bommo (7) ........MCDE..EVAALVVDNGSGMCKAGFAGDDA..PRAVFPSI.VGRPRHQGLMV......................................... Domain <------------- Ia or 1 ---------> <--------------------------- Ib or 2 -------- Act_Yeast (8) ........MDS...EVAALVIDNGSGMCKAGFAGDDA..PRAVFPSI.VGRPRHQGIMV......................................... Act_Thela (9) ........MEE...EVAALVIDNGSGMCKAGFAGDDA..PRAVFPSI.VGRPRHHGIMI......................................... Act_Schpo (10) ........MEE...EIAALVIDNGSGMCKAGFAGDDA..PRAVFPSI.VGRPRHHGIMV......................................... Act_Cryne (11) ........MEE...EVAALVIDNGSGMCKAGFAGDDA..PRAVFPSI.VGRPRHQGVMV......................................... Nucleotide n nnn n Act1_Maize (12) ........MAD.E.DIQPIVCDNGTGMVKAGFAGDDA..PRAVFPSI.VGRPRHTGVMV......................................... Act3_Pea (13) ........MAEAE.DIQPLVCDNGTGMVKAGFAGDDA..PRAVFPSI.VGRPRHTGVMV......................................... Act1_Dauca (14) ........MADGE.DIQPLVCDNGTGMVKAGFAGDDA..PRAVFPSI.VGRPRHTGVMV......................................... Act2_Dauca (15) ........MADGGEDIQPLVCDNGTGMVKAGFAGDDA..PRAVFPSIVVGRPRHTGVMV......................................... Act2_Pea (16) ........MADAE.DIQPLVCDNGTGMVKAGFAGDDA...RAVFPSI.VGRPRHTGVMV......................................... Act3_Soybn (17) ........MADAE.DIEPLVCDNGTGMVKAGFAGDDA..PRAVFPSI.VGRPRHTGVMV......................................... Cation + Act1_Acaca (18) ........MGD...EVQALVIDNGSGMCKAGFAGDDA..PRAVFPSI.VGRPRHTGVMV......................................... Actd_Phypo (19) ..............EGEAVVIDNGSGMCKAGFAGDNT..PRAMFPSI.VGHPRHTEAMM......................................... Act4_Dicdi (20) ........MERE..EVQAIVIDNGSDMCKAGFAGDDA..PRAVFQSI.VGRPRYTGVMD......................................... Act3_Dicdi (21) ........MESE..DVQALVIDNGSGMCKAGFAGDDA..PRAVFPSI.VGRPRYTGVMV......................................... Act_Enthi (22) ........MGDE..EVQALVVDNGSGMCKAGFAGDDA..PRAVFPSI.VGRPRHVSVMA......................................... Act_Phyme (23) ........MED...DIQAVVIDNGSGMCKAGFAGDDA..PRAVFPSI.VGMPKHLGIMV......................................... Act1_Naefo (24) ........MCD...DVQALVVDNGSGMCKAGFAGDDA..PRAVFPSI.IGRPKQKSIMV......................................... Act1_Plafa (25) ........MGEE..VVQALVVDNGSGNVKAGVAGDDA..PRSVFPSI.VGRPKNPGIMV......................................... Act2_Plafa (26) ........MSE...EAVALVVDNGSGMVKSGLAGDDA..PKCVFPSI.VGRPKMPNIMI......................................... Act_Leima (27) ........MADN..EQSSIVCDNGSGMVKAGFSGDDA..PRHVFPSI.VGRPKNMQAMM......................................... Act_Eupcr (28) ........MSEEENAKEAIVVDNGSGVVKAGFAGENQ..PCSVFPSV.VAKPKTKQVIVG........................................ Act1_Oxyno (29) ........MA....DKQTVVVDNGSGVVKAGFSGEDA..PRAVFPSI.IGRPKNVSALI......................................... Arp53D D mel .....MSSEVDSNSHHAAVVIDNGSGVCKAGFSPEDT..PRAVFPSI.VGRPRHLNVLL......................................... DNase <------------- DNase I Loop --------------- Arp1 H sap a .......MESYDVIANQPVVIDNGSGVIKAGFAGDQI..PKYCFPNY.VGRPKHVRVMA......................................... Arp1 H sap b .......MESYDIIANQPVVIDNGSGVIKAGFAGDQI..PKYCFPNY.VGRPKHMRVMA......................................... Arp1 D mel .......MEPYDVVVNQPVVIDNGSGVIKAGFAGEHI..PKCRFPNY.VGRPKHVRVMA......................................... Arp1 N cra .........MTDSLHNAPIVLDNGSGTIRAGFAGDDV..PKCHFPSF.VGRPKHLRVLA......................................... Arp1 P car .......MEFNDVLTNQPICIDNGSGVIKAGFAGEDQ..PKSFFPSY.VGRPKHLKIMA......................................... Arp1 S cer ....MDQLSDSYALYNQPVVIDNGSGIIKAGFSGEER..PKALEYCL.VGNTKYDKVML......................................... Actin aa Arp2 D mel .........MDRSKGRNVIVCDNGTGFVKCGYAGSNF..PTHIFPSM.VGRPMIRAVNKIG....................................... Arp2 G gal .........MDT.LGRKVVVCDNGTGFVKCGYAGSNF..PEHIFPAL.VGRPIIRSTAKVG....................................... Arp2 A cas .........MTD..SSKVIVCDNGTGFVKCGFARSNF..PASIFPSM.VGRPILRSEEKFD....................................... Arp2 S cer .........MD...PHNPIVLDQGTGFVKIGRAGENF..PDYTFPSI.VGRPILRAEERASV...................................... Arp2 C ele .........MDS.QGRKVIVVDNGTGFVKCGYAGTNF..PAHIFPSM.VGRPIVRSTQRVG....................................... Myosin mmmm mm m Arp3 S pom ..........MASFNVP.IIMDNGTGYSKLGYAGNDA..PSYVFPTVIATRSAGA.......SSGPAVSSKPSYM.............ASKGSGHLSSKR Arp3 S cer ..........MSYLNNPAVVMDNGTGLTKLGFAGNDS..PSWVFPTAIATAAPSNTKKSSGVGAPSAVSNEASYFGNSTSATNFNGATGGLLSNNLSGKR Arp3 B tau ...........MAGRLPACVVDCGTGYTKLGYAGNTE..PQFIIPSCIAIKESAKV..................................GDQAQRRVMK Arp3 D mel ...........MAGRLPACVIDVGTGYSKLGFAGNKE..PQFIIPSAIAIKESARV..................................GDTNTRRITK Arp3 D dis .........MNPASGLPAVVIDNGTGYTKMGYAGNND..PSFIIPTTIATQSSK....................................GKQTAASQKK Arp3 A cas ..........MSRSGLPAVVIDNGTGYTKMGYAGNTE..PQYIIPTAIATKGIAEDPR............................CRARRWWCPWAAGK Profilin Arp4 S cer ..MSNAALQVYGGDEVSAVVIDPGSYTTNIGYSGSDF..PQSILPSV.YGKYTADE............................................ Arp23D3 S pom ......MANDHTLEEIPSLVIDPGSCWTRFGYAGEES..PMTILPSY.YGVRSDVT............................................ Arp5 S cer RQTPEPFDEQSAYNPQSPIAIDFGSSKLRAGFVNHAT..PTHIFPNA.LTKFRDRKL........................................... Arp6 S cer .............METPPIVIDNGSYEIKFGPSTNKK..P.FRALNA.LAKDKF.............................................. ArpX D mel .............MANAVVVLDNGAHTAKVGLANQDE..P.HVVPNC.IMKAKSER............................................ ArpX C ele .............MSLTTIIFDNGGHNMKIGTIDSES..P.RLVPNS.IVKAKHEK............................................ Arp7 S cer ...........MTLNRKCVVIHNGSHRTVAGFSNVEL..PQCIIPSS.YIKRTDEG............................................ Arp8 S cer ASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDH..P.VVVPNC.VAVPKKWLDLENSEHV.........ENVCLQREQSEEFNNIKSEMEKNFRER Arp9 S cer .......MAPFRQDSILIIYPRSQTTLVQFGLNEETFTVPELEIPTQ.IYRTTRQD............................................ Arp10 S cer .............MSNTIVIVYLGANRIEIGRSADAC..PQEIIAWK.TGSI................................................     101 110 120 130 140 150 160 170 180 190 200 Position 52 56 61 65 68 79 92 103 107 Sec Struct bbbbhhhhh-----h bbbb hhhhhhhhhhhhhh bbbbb Acts_Human (1) GMGQKDSYVGDEAQS.....KRG.ILTLKYPIE....HGIITNWDDMEKIWHHTFYN.........................ELRVAP.EEHPTLLTEAP Act4_drome (2) GMGQKDCYVGDEAQS.....KRG.ILSLKYPIE....HGIITNWDDMEKVWHHTFYN.........................ELRVAP.EEHPVLLTEAP Acta_Limpo (3) GMGQKDSYVGDEAQS.....KRG.ILTLKYPIE....HGIVTNWDDMEKIWHHTFYN.........................ELRVAP.EEHPVLLTEAP Actb_Xenbo (4) GMGQKDSYVGDEAQS.....KRG.ILTLKYPIE....HGIVTNWDDMEKIWHHTFYN.........................ELRVAP.EEHPVLLTEAP Actm_Aplca (5) GMGQKDSYVGDEAQS.....KRG.ILTLKYPIE....HGIVTNWDDMEKIWHHTFYN.........................ELRVPP.EEHPVLLTEAP Act1_Podca (6) GMGQKDSYVGDEAQS.....KRG.ILTLKYPIE....HGIVTNWDDMEKIWHHTFYN.........................ELRVAP.EEHPVLLTEAP Act3_Bommo (7) GMGQKDSYVGDEAQS.....KRG.ILTLKYPIE....HGIVTNWDDMEKIWHHTFYN.........................ELRVAP.EEHPVLLTEAP Domain - Ib or 2 ---------------><------------------------------- Ia or 1 --------------------------- Act_Yeast (8) GMGQKDSYVGDEAQS.....KRG.ILTLRYPIE....HGIVTNWDDMEKIWHHTFYN.........................ELRVAP.EEHPVLLTEAP Act_Thela (9) GMGQKDSYVGDEAQS.....KRG.VLSLRYPIE....HGVVTNWDDMEKIWHHTFYN.........................ELRVAP.EEHPVLLTEAP Act_Schpo (10) GMGQKDSYVGDEAQS.....KRG.ILTLKYPIE....HGIVNNWDDMEKIWHHTFYN.........................ELRVAP.EEHPCLLTEAP Act_Cryne (11) GMGQKDSYVGDEAQS.....KRG.ILTLKYPIE....HGIVTNWDDMEKIWHHTFYN.........................ELRVAP.EDDPVLLTEAP Nucleotide Act1_Maize (12) GMGQKDAYVGDEAQA.....KRG.ILTLKYPIE....HGIVNNWDDMEN.WHHTFYN.........................ELRVSP.EDHPVLLTEAP Act3_Pea (13) GMGQKDAYVGDEAQS.....KRG.ILTLKYPIE....HGIVSNWDDMEKIWHHTFYN.........................ELRVAP.EEHPVLLTEAP Act1_Dauca (14) GMGQKDAYVGDEAQS.....KRG.IITLKYPIE....HGIVSNWDDM.RIWHHTFYN.........................ELRASP.EEHPVLLTEAP Act2_Dauca (15) GMGQKDAYVGDEAQS.....KRG.ILTLKYPIE....HGIVSNWDDMEKISHHTFYN.........................ELRVAP.EEHPVLLTEAP Act2_Pea (16) GMGQKDAYVGDEAQS.....KRG.ILTLKYPIE....HGIVSNWDDMEKIWHHTFYN.........................ELRVAP.EEHPVLLTEAP Act3_Soybn (17) GMGQKDXYVGDEAQS.....KRG.ILTLKYPIE....HGIVSNWDDMEKIWHHTFYN.........................ELRVVS.EEPXVLSXEAP Cation Act1_Acaca (18) GMGQKDSYVGDEAQS.....KRG.ILTLKYPIE....HGIVTNWDDMEKIWHHTFYN.........................ELRVAP.EEHPVLLTEAP Actd_Phypo (19) EIGHKHSYVGDEAQS.....KRG.ILALKYPIE....QGIVNNWDDMEQIWHHTFYN.........................EMRVAP.EEHPVLLTEAP Act4_Dicdi (20) VMGQKDSYIVDEAHS.....RKG.FLTLKYPIE....RGIVTNWDDMEEIWHHTFYN.........................ELGVAP.EEHPVLLTEQP Act3_Dicdi (21) GMGQKDSYIGDEAQS.....RKG.ILTLKYPIE....HGIVTNWDDMEKIWHHTFYN.........................ELRVAP.EEHPVLLTEAP Act_Enthi (22) GMGQKDAYVGDEAQS.....KRG.ILTLKYPIE....HGIVNNWDDMEKIWHHTFYN.........................ELRVAP.EEHPVLLTEAP Act_Phyme (23) GMNQKDAYIGDEAQA.....KRG.VLTLRYPIE....HGIVTNWDDMEKIWSHTFYN.........................ELRVAP.EEHPVLLTEAP Act1_Naefo (24) GMGNKDAYVGDEVQS.....KRG.ILTLKYPIE....HGIVTNWDDMEKIWHHTFYN.........................ELRVAP.EEHPVLLTEAP Act1_Plafa (25) GMEEKDAFVGDEAQT.....KRG.ILTLKYPIE....HGIVTNWDDMEKIWHHTFYN.........................ELRAAP.EEHPVLLTEAP Act2_Plafa (26) GMEQKECYVGDEAQN.....KRG.ILTLKYPIE....HGIVTNWDDMEKIWHHTFYN.........................ELRVSP.EEHPVLLTEAP Act_Leima (27) GSANKTVYVGDEAQS.....KRG.VLSLKYPIE....HGIVTNWDDMEKIWHHTFYN.........................DVRVNP.EQHNVLLTEAP Act_Eupcr (28) GAGNKDCFVGDERQQ.....KRG.VCTLSYPIK....SGMIKDWDGMQKIWDYTFYN.........................ELRIET.ENHPVLLTEAP Act1_Oxyno (29) GVDSASEYIGDEAQQ.....KRG.VLKIFYPIE....HGIIKDWEDMEKIWNHTFYV.........................ELRVQP.DEHPVLLTEAP Arp53D D mel DSVIGDSVIGERQPE.....KRG.ILTLKYPIE....HGMVKNWDEMEMVWQHTYE..........................LLRADP.MDLPALLTEAP DNase ----> d d Arp1 H sap a GALEGDIFIGPKAEE.....HRG.LLSIRYPME....HGIVKDWNDMERIWQYVYSK........................DQLQTFS.EEHPVLLTEAP Arp1 H sap b GALEGDLFIGPKAEE.....HRG.LLTIRYPME....HGVVRDWNDMERIWQYVYSK........................DQLQTFS.EEHPVLLTEAP Arp1 D mel GALEGDIFVGPKAEE.....HRG.LLSIRYPME....HGIVTDWNDMERIWSYIYSK........................EQLATFT.EDHPVLLTEAP Arp1 N cra GALEGEVFIGQKAASE....LRG.LLKIRYPLE....HGIVTDWDDMEKIWAYVYD.........................EGLKTLS.EEHPVLLTEPP Arp1 P car GAIEGDIFIGNKAQE.....LRG.LLKIKYPIE....HGIVVDWDDMERIWQFIYT.........................EELKTVS.EEHPVLLTEAP Arp1 S cer EGLQGDTFIGNNAQK.....LRG.LLKLRYPIK....HGVVEDWDSMELIWSYVLN.........................EVLQLQNIGEHPLLITEAP Actin a a Arp2 D mel DIEVKDLMVGDEASQ.....LRS.LLEVSYPME....NGVVRNWDDMCHVWEYTFGP........................KKMDIDP.TNTKILLTEPP Arp2 G gal NIEIKDLMVGDEASE.....LRS.MLEVNYPME....NGIVRNWDDMKHLWDYTFGP........................EKLNIDT.KNCKILLTEPP Arp2 A cas NVEIKDIMVGDEASK.....LRS.MLQITYPLD....NGIVRNWEDAEHVWNYTFF.........................EKLKVDP.KDCKILLTEPP Arp2 S cer ATPLKDIMIGDEASE.....VRS.YLQISYPME....NGIIKNWTDMELLWDYAFFE........................QMKLPST.SNGKILLTEPP Arp2 C ele NIEIKDLMVGEECSQ.....LRQ.MLDINYPMD....NGIVRNWDDMAHVWDHTFGP........................EKLDIDP.KECKLLLTEPP Myosin m m mm Arp3 S pom ATEDLDFFIGNDALK.....KASAGYSLDYPIR....HGQIENWDHMERFWQQSLFK.........................YLRCEP.EDHYFLLTEPP Arp3 S cer GTEDLDFYIGNEALVA....SQGPSYSLSYPIR....HGQVENWDHMERFWENSIFK.........................YLRTEP.EDHFFLLTEPP Arp3 B tau GVDDLDFFIGDEAIE......KP.TYATKWPIR....HGIVEDWDLMERFMEQVIFK.........................YLRAEP.EDHYFLLTEPP Arp3 D mel GIEDLDFFIGDEAFD......RT.GYSIKYPVR....HGLVEDWDLMERFLEQCVFK.........................YLRAEP.EDHYFLLTEPP Arp3 D dis GVEDLDFFIGDEAIA.....NSK.TYDMTNPVK....HGQIENWTHMEQYWEHCVFK.........................YLRCEP.EDHYFLLTEPP Arp3 A cas NIADLDFFIGDEAYE.....NSK.VYQITMPVR....HGQVENWTHMEQFWEHCIFK.........................YLRCEP.EDHHFLLTEPP Profilin Arp4 S cer ..G.NKKIFSEQSIGI....PRK.DYELKPIIE....NGLVIDWDTAQEQWQWALQN.........................ELYLNSNSGIPALLTEPV Arp23D3 S pom ..GRNKYVVDELQIHA....PIP.GMEVKNGKS....NGIIQDWESTLYTWERGLKE.........................KLQVNP.TEYAMMITEPS Arp5 S cer ..NKNFTFVGNDTLL.....DQAVRSQSRSPFD....GPFVTNWNLTEEILDYTFHH........................LGVVPDNGIPNPILLTERL Arp6 S cer ....GTSYLSNHIKNI....KDISSITFRRPHE....LGQLTLWELESCIWDYCLFN...................PSEFDGFDLKEG.KGHHLVASESC ArpX D mel ....RRAFVGNQIDEC....RDTSALYYILAFQ....RGYLLNWHTQKTVWDYIFSK........................DGIGCSL.ENRNIVITEPQ ArpX C ele ....KRVFVAHEQEEC....SDKFSLFYVRPIE....RGYVVNWDTQQQIWEKTFGS..........................MDVEA.STSRIALTDNN Arp7 S cer ..GEAEFIFGTYNMIDAAAEKRNGDEVYTLVDS....QGLPYNWDALEMQWRYLYDT.........................QLKVSP.EELPLVITMPA Arp8 S cer MRYYKRKVPGNAHEQ.....VVSFNENSKPEIISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPFRGGSFNVKSPYYKSLAELISDVTKLLEHA Arp9 S cer .....GSYTYHSTNK.....DNK..AELIKPIQ....NGEIIDISAFTQFLRLIFVSILSDRAN..............KNQDAFEAELSNIPLLLITHHS Arp10 S cer ......EKNREELKK..........IFEHYFQI....CNILGNREVQVLILEDIFIS..........................VVEKR.IICSILFKEFD     201 210 220 230 240 250 260 270 280 290 300 Position 116 125 131 137 144 Sec Struct hhhhhhhhh bbbbbb hhhhhhhh Acts_Human (1) LN........................PKANREKMTQIMFETFNVPAMYVA..IQAVLSLYAS...................................... Act4_drome (2) LN........................PKANREKMTQIMFETFNSPAMYVA..IQAVLSLYAS...................................... Acta_Limpo (3) LN........................PKANREKMTQIMFETFNTPAMYVA..IQAVLSLYAS...................................... Actb_Xenbo (4) LN........................PKANREKMTQIMFETFNTPAMYVA..IQAVLSLYAS...................................... Actm_Aplca (5) LN........................PKANREKMTQIMFETFNAPAMYVA..IQAVLSLYAS...................................... Act1_Podca (6) LN........................PKANREKMTQIMFETFNSPAMYVA..IQAVLSLYAS...................................... Act3_Bommo (7) LN........................PKANREKMTQIMFETFNTPAMYVA..IQAVLSLYAS...................................... Domain ------------------ Ia or 1 -------------------------------> Act_Yeast (8) MN........................PKSNREKMTQIMFETFNVPAFYVS..IQAVLSLYSS...................................... Act_Thela (9) IN........................PKSNREKMTQIVFETFNAPAFYVS..IQAVLSLYAS...................................... Act_Schpo (10) LN........................PKSNREKMTQIIFETFNAPAFYVA..IQAVLSLYAS...................................... Act_Cryne (11) LN........................PKQNREKMTQIMFESFNAPAFYVS..IQAVLSLYAS...................................... Nucleotide n Act1_Maize (12) LN........................PKANREKMTQIMFETFECPAMYVA..IEAVLSLYAS...................................... Act3_Pea (13) LN........................PKANREKMTQIMFETFNTPAMYVA..IQAVLSLYAS...................................... Act1_Dauca (14) LN........................PKANREKMTQIMIETFNVPAMYVA..IQAVLSLYAS...................................... Act2_Dauca (15) LN........................PKANREKMTQIMFETFNVPAMYVLSRLRSCLSLYAS...................................... Act2_Pea (16) LN........................PKANREKMTQIMFETFNVPAMYVA..IQAVLSLYAS...................................... Act3_Soybn (17) LN........................PKVNRES.AQIMFETFNVPAMYVA..IQAVLSLYAS...................................... Cation + Act1_Acaca (18) LN........................PKANREKMTQIMFETFNTPAMYVA..IQAVLSLYAS...................................... Actd_Phypo (19) LN........................PKANREKMTQIMFESFSAPAMYVA..IQAVLSLRAS...................................... Act4_Dicdi (20) LN........................PKKNREKMTQIMFETFNTPAMYVA..IQAVLSLYSS...................................... Act3_Dicdi (21) LN........................PKRNREKMTQIMFETFNTPAMYVA..IQAVLSLYAS...................................... Act_Enthi (22) MN........................PKANREKMTQIMFETFNTPAMYVG..IQAVLSLYAS...................................... Act_Phyme (23) LN........................PKANRERMTQIMFETFNVPAMYVN..IQAVLSLYAS...................................... Act1_Naefo (24) LN........................PKANREKMTQIMFETFSVPAMYVA..IQAVLSLYAS...................................... Act1_Plafa (25) LN........................PKGNRERMTQIMFESFNVPAMYVA..IQAVLSLYSS...................................... Act2_Plafa (26) LN........................PKTNREKMTQIMFETFDVPAMYVS..IQAILSLYAS...................................... Act_Leima (27) MN........................PKQNREKMTQIMFETFNVPSLYIG..IQAVLSLYSS...................................... Act_Eupcr (28) LN........................PKQNRENMCRIMFEEYDFPSMYIQ..IQAVLSLYSA...................................... Act1_Oxyno (29) LN........................PKTNREKMTQIMFETFNVPALYVA..IQAVLSLYSA...................................... Arp53D D mel LN........................PKKNREKMTEIMFEHFQVPAFYVA..VQAVLSLCTT...................................... Dnase Arp1 H sap a LN........................PRKNRERAAEVFFETFNVPALFIS..MQAVLSLYAT...................................... Arp1 H sap b LN........................PSKNREKAAEVFFETFNVPALFIS..MQAVLSLYAT...................................... Arp1 D mel LN........................PRRNREKAAEFFFEGINAPALFVS..MQAVLSLYAT...................................... Arp1 N cra LN........................PRANRDTAAQILFETFNVPALYTS..IQAVLSLYAS...................................... Arp1 P car LN........................PRTNRDQAAQVFFETFNVPALFTS..IQAVLSLYAS...................................... Arp1 S cer MN........................PLKNREQMAQVLFETFDVSALYVS..NPAVLSLYAS...................................... Actin Arp2 D mel MN........................PTKNREKMIEVMFEKYGFDSAYIA..IQAAWTLYAQ...................................... Arp2 G gal MN........................PTKNREKIVEVMFETYQFSGVYVA..IQAVLTLYAQ...................................... Arp2 A cas MN........................PLANREKMVQVMFEKYGFKAAYIA..IQAVLTLYAQ...................................... Arp2 S cer MN........................PLKNREKMCEVMFEKYDFGGVYVA..IQAVLALYAQ...................................... Arp2 C ele LN........................PNSNREKMFQVMFEQYGFNSIYVA..VQAVLTLYAQ...................................... Myosin Arp3 S pom LN........................PPENRENTAEIMFESFNCAGLYIA..VQAVLALAASWTSSKVT............................... Arp3 S cer LN........................PPENREQVAEIFFESFNCAGLYIA..VQAVLALAASWTSSKVT............................... Arp3 B tau LN........................TPENREYTAEIMFESFNVPGLYIA..VQAVLALAASWTSRQVG............................... Arp3 D mel LN........................TPENREYTAEIMFETFNVPGLYIA..VQAVLALAASWASRSAE............................... Arp3 D dis LN........................APENREFTAEIMFETFNVPGLYIA..VQAVLALAASWTSKN.A............................... Arp3 A cas LN........................APENREYTAEIMFETFNVPGLYIA..VQAVLALAASWTSKQVT............................... Profilin p Arp4 S cer WN........................STENRKKSLEVLLEGMQFEACYLA..PTSTCVSFAA...................................... Arp23D3 S pom WN........................PQSVRQQIMEAAFEQLHVPAFYLT..KQAVCVAFAN...................................... Arp5 S cer AT........................VQSQRTNWYQILFETYNVPGVTFG..IDSLFSFYNYNPS................................... Arp6 S cer MT........................LPELSKHADQVIFEEYEFDSLFKS..PVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQD ArpX D mel MN........................FQSIQEATLEILFEEYKVDGVYKT..TAADLAAFNYVADSEERTT............................. ArpX C ele YL........................IPALPDVSSEILFDYFGFTEVHKT..SASTLVAKHSNKINN................................. Arp7 S cer TN.....................GKPDMAILERYYELAFDKLNVPVFQIV..IEPLAIALSM...................................... Arp8 S cer LNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAII..QESLATCYGA...................................... Arp9 S cer WS.........................QSDLEIITQYVFESLEINNLIQL..PASLAATYSM...................................... Arp10 S cer CA............................HVSFVPRAIVHCLSCNTRNA..................................................     301 310 320 330 340 350 360 370 380 390 400 Position 150 160 175 182 194 Sec Struct bbbbbb bbbbbbb bbbb hhhhhhhhhhhhh Acts_Human (1) ...GRT.TGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTER.GYS......................................... Act4_drome (2) ...GRT.TGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER.GYS......................................... Acta_Limpo (3) ...GRT.TGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER.GYS......................................... Actb_Xenbo (4) ...GRT.TGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER.GYS......................................... Actm_Aplca (5) ...GRT.TGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLSKILTER.GYS......................................... Act1_Podca (6) ...GRT.TGIVLDSGDGVSHTVPIYEGYALPHAIIRLDLAGRDLTDYMMKILTER.GYS......................................... Act3_Bommo (7) ...GRT.TGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER.GYS......................................... Domain <-------- IIa or 3 --------> <----- IIb or 4 -------------------------------------- Act_Yeast (8) ...GRT.TGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSER.GYS......................................... Act_Thela (9) ...GRT.TGIVLDSGDGVTHTVPIYEGFALTHAISRIDIAGRDLTDYLMKILAER.GYS......................................... Act_Schpo (10) ...GRT.TGIVLDSGDGVTHTVPIYEGYALPHAIMRLDLAGRDLTDYLMKILMER.GYT......................................... Act_Cryne (11) ...GRT.TGIVLDSGDGVTHTVPIYEGFSLPHAILRIDLAGRDLTDYLVKILMER.GYL......................................... Nucleotide n nnn Act1_Maize (12) ...GRT.TGIVMDSGDGVSHTVPIYEGYTLPHAILRLDLAGRDLTDHLMKILTER.GYS......................................... Act3_Pea (13) ...GRT.TGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDGLMKILTER.GYT......................................... Act1_Dauca (14) ...GRT.TGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDGLMKILTEK.SIC......................................... Act2_Dauca (15) ...GRT.TGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDGLMKILTER.GYM......................................... Act2_Pea (16) ...GRT.TGIVLESGDGVSHTVPIYEGYALPHAILRLDLAGRDLTESLMKILTER.GYM......................................... Act3_Soybn (17) ...GRT.TGIVLDSGDGVSHTVPIYEGDALPHAILRLDLAGRDLTDHLMKILTER.GYM......................................... Cation + Act1_Acaca (18) ...GRT.TGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER.GYS......................................... Actd_Phypo (19) ...GRT.TGIVLDSGDGASHAVPIYEGCALPHAILRIDAAGRDLTHYLRLMLAER.GYA......................................... Act4_Dicdi (20) ...GRT.TGIVMDSGDGVSHAVSIYEGHALPHAILRLDLAGRDLSDYMMKILTKR.GYS......................................... Act3_Dicdi (21) ...GRT.TGIVMDSGDGVSHTVPIYEGYSLPHAILRLDLAGRDLTDYMMKILTER.GYS......................................... Act_Enthi (22) ...GRT.TGIVMDSGDGVSHTVPIYEGFSLPHAILRLDLAGRDLTDYLMKILTER.GYA......................................... Act_Phyme (23) ...GRT.TGCVLDSGDGVSHTVPIYEGYALPHAIVRLDLAGRDLTDYMMKILTER.GYS......................................... Act1_Naefo (24) ...GRT.TGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILMER.GYS......................................... Act1_Plafa (25) ...GRT.TGIVLDSGDGVSHTVPIYEGYALPHAIMRLDLAGRDLTEYLMKILHER.GYG......................................... Act2_Plafa (26) ...GRT.TGIVLDSGDGVSHTVPIYEGYVLPHAINRIDMAGRDLTYHMMKWFTER.GHT......................................... Act_Leima (27) ...GRT.TGIVLDAGDGVTHTVPIYEGYSLPHAVRRVDMAGRDLTEYLMKIMMET.GTT......................................... Act_Eupcr (28) ...GRT.TGIVVDSGDGVTHVVPIFEGYQIPHAIEKILLAGRDLTDYMCRILKDD.DYH......................................... Act1_Oxyno (29) ...GRT.TGIVCDAGDGVTHTVPIYEGFSIPHAVSRIQLAGRDLTTFMAKLLTEK.GYV......................................... Arp53D D mel ...GRT.VGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKLLLER.GVT......................................... Dnase Arp1 H sap a ...GRT.TGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKE.GYD......................................... Arp1 H sap b ...GRT.TGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKE.GVD......................................... Arp1 D mel ...GRV.TGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRRE.GFN......................................... Arp1 N cra ...GRT.TGVVLDSGDGVSHAVPVYQGFTVPNSIRRIDVAGRDVTEYLQTLLRKS.GYV......................................... Arp1 P car ...GRT.TGVVLDSGDGVTHAVPIYEGFAMPSAIRRIDIAGRDVTEYLQLLLRKS.GTI......................................... Arp1 S cer ...GRT.TGCVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVS......................................... Actin aaaa Arp2 D mel ...GLI.SGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGRDITRYLIKLLLLR.GYA......................................... Arp2 G gal ...GLL.TGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLR.GYA......................................... Arp2 A cas ...GLL.TGVVVDSGDGVTHIVPVYEGFSLPHLTRRLNVAGRDVTRYLIKLLLLR.GYV......................................... Arp2 S cer ...GLS.SGVVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRR.GYA......................................... Arp2 C ele ...GLL.TGVVVDSGDGVTHICPVYEGFALHHLTRRLDIAGRDITKYLIKLLLQR.GYN......................................... Myosin Arp3 S pom ...DRSLTGTVVDSGDGVTHIIPVAEGYVIGSSIKTMPLAGRDVTYFVQSLLRDR............................................. Arp3 S cer ...DRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER............................................. Arp3 B tau ...ERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDR.EVG......................................... Arp3 D mel ...ERTLTGIVVDSGDGVTDVIPVAEGYVIGSCIKHIPIAGRNITSLIQSLLRER.EVG......................................... Arp3 D dis ...EKTLTGTVIDSGDGVTHVIPISEGYVIGSSIKHIPIAGRDISSYVQQIMRER.EPN......................................... Arp3 A cas ...EKTLTGTVIDSGDGVTHVIPVAEGYVIGSSIKHIPLAGRDITNFVLQLLRER.NEK......................................... Profilin pp p ppp Arp4 S cer ...GRP.NCLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKALEPKEIIPLFAIK.QRKPEFIKKT.................FDYEVDKS Arp23D3 S pom ...SKS.TALIVDIGSDNASVTPVVDGLIIRKGIFKQSLAGDFLNANIEQLFNTMNIEFPPHYRIARKSVAIQQSGNMANGSADAVKPAVLYPPIQDLTS Arp5 S cer ...GNK.TGLVISCGHEDTNVIPVVDGAGILTDAKRINWGGHQAVDYLNDLMALKYPYF......................................... Arp6 S cer SGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH............................................ ArpX D mel ...MESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTNQLKELISYRH............................................ ArpX C ele ...EK..CAVVVDSGFSWTTVASFVNGMLIQDSVIRIDVGGKALTNKLKDWVSYRQ............................................ Arp7 S cer ...GKS.SAFVIDIGASGCNVTPIIDGIVVKNAVVRSKFGGDFLDFQVHERLAPLIKEENDMENM.........ADEQKRSTDVWYEASTWIQQFKSTML Arp8 S cer ...GISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLLQSDFPL......................................QDW Arp9 S cer ...ISLQNCCIIDVGTHHTDIIPIVDYAQLDHLVSSIPMGGQSINDSLKKLL................................................ Arp10 S cer .........IVIDIGTNYTTCVPIFDLRPLQQFIKYSK.RGKRQVE......................................................     401 410 420 430 440 450 460 470 480 490 500 Position 203 216 223 230 238 247 Sec Struct hhhhhhhhhhhhhh hhhhhhhh bbbb bbbb Acts_Human (1) .FVTTAEREIVRDIKEKL.CYVALDFENEMATAASSS............SLEKSYELPDGQVITIGN................................. Act4_drome (2) .FTTTAEREIVRDIKEKL.CYVALDFEQEMATAAAST............SLEKSYELPDGQVITIGN................................. Acta_Limpo (3) .FTTTAEREIVRDIKEKL.CYVALDFEHEMTTAASSS............SLEKSYELPDGQVITIGN................................. Actb_Xenbo (4) .FTTTAEREIVRDIKEKL.CYVALDFEQEMATAASSS............SLEKSYELPDGQVITIGN................................. Actm_Aplca (4) .FTTTAEREIVRDIKEKL.CYVALDFEQEMATAASSS............SLEKSYELPDGQVITIGN................................. Act1_Podca (6) .FTTTAEREIVRDIKEKL.AYVALDFEQEMQTAASSS............SLEKSYELPDGQVITIGN................................. Act3_Bommo (7) .FTTTAEREIVRDIKEKL.CYVALDFEQEMATAASSS............SLEKSYELPDGQVITIGN................................. Domain ------------------------------ IIb or 4 -------------------------------------------------------- Act_Yeast (8) .FSTTAEREIVRDIKEKL.CYVALDFEQEMQTAAQSS............SIEKSYELPDGQVITIGN................................. Act_Thela (9) .FTTTAEREIVRDIKEKL.CYVAFDFEQELQTAAQSS............TLEKSYELPDGQVITIGN................................. Act_Schpo (10) .FSTTAEREIVRDIKEKL.CYVALDFEQELQTAAQSS............SLEKSYELPDGQVITIGN................................. Act_Cryne (11) .FTTSAEREIVRDIKEKL.CYVALDCEQELQTAAQSS............QLEKSYELPDGQVITIGN................................. Nucleotide nn Act1_Maize (12) .LTTSAEREIVRDIKEKL.AYVALDYEQELETAKSSS............SVEKSYEMPDGQVITIGS................................. Act3_Pea (13) .FTTSAEREIVRDMKEKL.AYIALDYEQELETAKTSS............AVEKTYELPDGQVITIGA................................. Act1_Dauca (14) .HYTTAEREIVRDMKEKL.AYVALDYEQELETAKRRS............AVEKNYELPDGQVITIGA................................. Act2_Dauca (15) .FTTTA..TGMSYMKEKL.AYVALVMSKSWRLPRARL............LVEKNYELPDGQVITIGAV................................ Act2_Pea (16) .FTTSAEREIVRDIKEKL.AYVALDYEQELETAKSSS............SIEKNYELPDGQVITIGA................................. Act3_Soybn (17) .FTTSAEREIVRDMKEKL.AYVALDYEQELETAKSSS............SVEKSHELPDGQVITIGA................................. Cation Act1_Acaca (18) .FTTTAEREIVRDIKEKL.CYVALDFEQEMHTAASSS............ALEKSYELPDGQVITIGN................................. Actd_Phypo (19) .FNTTAELEIVRDIKEKL.AYVALDFEQEMQTAS...............SL..NYELPDGRVVTIGN................................. Act4_Dicdi (20) .FTTTAEKEIIKDIKEKL.SYVALDFDAEMLTAASST............TLEKSYELPDGKVITIGN................................. Act3_Dicdi (21) .FTTTAEREIVRDIKEKL.AYVALDFEAELQTAASSS............ALEKSYELPDGQVITIGN................................. Act_Enthi (22) .FTTTAEREIVRDIKEKL.CYVAEDFNEEMQKAASSS............ELEKSYELPDGQVITVGN................................. Act_Phyme (23) .FTTTAEREIVRDIKEKL.TYVAMNFDEEMEKAARSS............TLDKSYELPDGNVIVIGN................................. Act1_Naefo (24) .FNTTAEREIVRDIKEKL.CYIALDFEQEMKIAAESS............SVEKSYELPDGNVITVGN................................. Act1_Plafa (25) .FSTSAEKEIVRDIKEKL.CYIALNFDEEMKTSEQSS............DIEKSYELPDGNIITVGN................................. Act2_Plafa (26) .FTTTAEREIVRDIKEKL.CYIAMDYDEELKRSEEHS...........DEIEEIYELPDGNLITVGS................................. Act_Leima (27) .FTTTAEKEIVRNVKEQL.CYVALDFEEEMTNSAKS.............ANEEAFELPDGNVMMVGN................................. Act_Eupcr (28) .FETTAEKETVRDIKEKL.CYVADDYEAELKKAGEGG............ELEESYALPDGRPLKIST................................. Act1_Oxyno (29) .FTSSAEMEIVRDIKEKL.CFVALDYEAAMKQSYEST............TFEKNYELPDGRVITIGN................................. Arp53D D mel .MGTSAEREIVREIKEKL.CYVSMNYAKEMDLH................GKVETYELPDGQKIVLGC................................. DNase d d Arp1 H sap a .FHSSSEFEIVKAIKERA.CYLSINPQKDETL................ETEKAQYYLPDGSTIEIGP................................. Arp1 H sap b .FHTSAEFEVVRTIKERA.CYLSINPQKDEAL................ETEKVQYTLPDGSTLDVGP................................. Arp1 D mel .FRSTAEFEIVRSIKEKV.CYLATNPQKEETV................ETEKFAYKLPDGKIFEIGP................................. Arp1 N cra .FHTSAEKEVVRLIKESV.TYVAHDPRKEEKEWAAAKM.........DPAKIAEYVLPDGNKLKIGA................................. Arp1 P car .FHTSAEKEIVRIIKEKC.SYVTLDPRKEEKEWINASI.....SGGKDYTKEEEFKLPDGNVLRLGA................................. Arp1 S cer .LFSSSEREIVRTMKEKV.CYLAKNIKKEEEKYLQGT...........QDLISTFKLPDGRCIEVGN................................. Actin a aa aaa Arp2 D mel .FNHSADFETVRIMKEKL.CYIGYDIEMEQRLALETT............VLVESYTLPDGRVIKVGG................................. Arp2 G gal .FNHSADFETVRMIKEKL.CYVGYNIEQEQKLALETT............VLVESYTLPDGRIIKVGG................................. Arp2 A cas .FNRTADFETVRQIKEKF.CYVGYDLELEKRLALETT............TLVEKYTLPDGRVIPIGA................................. Arp2 S cer .FNRTADFETVRQIKEKL.CYVSYDLDLDTKLARETT............ALVESYELPDGRTIKVGQ................................. Arp2 C ele .FNHSADFETVRQMKEKL.CYIAYDVEQEERLALETT............VLSQQYTLPDGRVIRLGG................................. Myosin Arp3 S pom .NEPDSSLKTAERIKEEC.CYVCPDIVKEFSRFDREPDRYLK.......YASESIT.GHSTTIDVGF................................. Arp3 S cer .GEADTSLRTAEKIKQEY.CYVCPDIVKEFNKFDKDPSKFAQ......FVVENQEK.TRRKVVDIGY................................. Arp3 B tau .IPPEQSLETAKAVKERY.SYVCPDLVKEFNKYDTDGSKWIKQ.....YTGINAIS.KKEFSIDVGY................................. Arp3 D mel .IPPEQSLETAKAIKEKH.CYICPDIAKEFAKYDTEPGKWIRN.....FSGVNTVT.KAPFNVDVGY................................. Arp3 D dis .IPPAESLEIAKRVKEQY.SYVCPDIVKEFGKYDSEPDKWIKT.....INAQDSVT.KKPFSYDVGY................................. Arp3 A cas .IPPAETLEVAKRIKETF.SYVCPDIVKEFKKYDTEPDKWFKT.....YEGIESVG.KKPYNVDVGY................................. Profilin Arp4 S cer LYDYANNRGFFQECKETL.CHICPTKTLEETKTELSS............TAKRSIESPWNEEIVFDNE................................ Arp23D3 S pom SYEIFQKRRVIEEWKESV.LDVLDTPFDEAKASS...............RNPKPFEFPDGVTHKFGQ................................. Arp5 S cer .PTKMSYLQYETMYKD.Y.CYVSRNYDEDIEKILTL.........ENLDTNDVVVEAPFTEVLQPQKTEEELRIQAEKRKETGKRLQEQAYFSKVRDQLI Arp6 S cer .YNMMDETILVNNIKEQC.LFVSPVSYFDSFKTKD..............KHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITLTD........... ArpX D mel .LNVMDESHVVNQIKEDV.CFVAEDFKQAMQVHYSEEKRR.........EVTVDYVLPDFTTVKRGYVRVPGKPREDEEQQQMVSLCN............ ArpX C ele .LNVSEETYVINECKEDL.CFVSQNFDESMKEARNRFQGN.........TTMKRYIMPDFHSTFRGVVKDVKEPH..DPQIPSIHLGV............ Arp7 S cer QVSEKDLFELERYYKEQADIYAKQQEQLKQMDQQLQYTALTGSPNNPLVQKKNFLFKPLNKTLTLDLK................................ Arp8 S cer KIDSKHGWLLAERLKKNFTTFQDADVAVQLYN.................FMNRSPNQPTEKYEFKLFD................................ Arp9 S cer ...PQWDDDQIESLKKSP.IFEVLSDDAKKLSS..FDFGNENEDEDEGTLNVAEII.TSGRDTREVLEERERGQKV........................ Arp10 S cer ....................................................................................................     501 510 520 530 540 550 560 570 580 590 600 Position Sec Struct Acts_Human (1) .................................................................................................... Act4_drome (2) .................................................................................................... Acta_Limpo (3) .................................................................................................... Actb_Xenbo (4) .................................................................................................... Actm_Aplca (5) .................................................................................................... Act1_Podca (6) .................................................................................................... Act3_Bommo (7) .................................................................................................... Domain ---------------------------- IIb or 4 -------------------------------------------------------- Act_Yeast (8) .................................................................................................... Act_Thela (9) .................................................................................................... Act_Schpo (10) .................................................................................................... Act_Cryne (11) .................................................................................................... Nucleotide Act1_Maize (12) .................................................................................................... Act3_Pea (13) .................................................................................................... Act1_Dauca (14) .................................................................................................... Act2_Dauca (15) .................................................................................................... Act2_Pea (16) .................................................................................................... Act3_Soybn (17) .................................................................................................... Cation Act1_Acaca (18) .................................................................................................... Actd_Phypo (19) .................................................................................................... Act4_Dicdi (20) .................................................................................................... Act3_Dicdi (21) .................................................................................................... Act_Enthi (22) .................................................................................................... Act_Phyme (23) .................................................................................................... Act1_Naefo (24) .................................................................................................... Act1_Plafa (25) .................................................................................................... Act2_Plafa (26) .................................................................................................... Act_Leima (27) .................................................................................................... Act_Eupcr (28) .................................................................................................... Act1_Oxyno (29) .................................................................................................... Arp53D D mel .................................................................................................... DNase Arp1 H sap a .................................................................................................... Arp1 H sap b .................................................................................................... Arp1 D mel .................................................................................................... Arp1 N cra .................................................................................................... Arp1 P car .................................................................................................... Arp1 S cer .................................................................................................... Actin Arp2 D mel .................................................................................................... Arp2 G gal .................................................................................................... Arp2 A cas .................................................................................................... Arp2 S cer .................................................................................................... Arp2 C ele .................................................................................................... Myosin Arp3 S pom .................................................................................................... Arp3 S cer .................................................................................................... Arp3 B tau .................................................................................................... Arp3 D mel .................................................................................................... Arp3 D dis .................................................................................................... Arp3 A cas .................................................................................................... Profilin Arp4 S cer .................................................................................................... Arp23D3 S pom .................................................................................................... Arp5 S cer DEPKKKVLSVLQNAGFDDERDFKKYLHSLEQSLKKAQMVEAEDDSHLDEMNEDKTAQKFDLLDIADEDLNEDQIKEKRKQRFLKASQDARQKAKEEKERV Arp6 S cer .................................................................................................... ArpX D mel .................................................................................................... ArpX C ele .................................................................................................... Arp7 S cer .................................................................................................... Arp8 S cer .................................................................................................... Arp9 S cer .................................................................................................... Arp10 S cer ....................................................................................................     601 610 620 630 640 650 660 670 680 690 700 Position 253 262 Sec Struct hhhhhhhhhh Acts_Human (1) ..........................................................................................ERFRCPETLF Act4_drome (2) ..........................................................................................ERFRTPEALF Acta_Limpo (3) ..........................................................................................ERFRCPEAMF Actb_Xenbo (4) ..........................................................................................ERFRCPEALF Actm_Aplca (5) ..........................................................................................ERFRCPESLF Act1_Podca (6) ..........................................................................................ERFRDPEALF Act3_Bommo (7) ..........................................................................................ERFRCPEALF Domain -------------------------- IIb or 4 --------------------------------------------IIb or 4 --- Act_Yeast (8) ..........................................................................................ERFRAPEALF Act_Thela (9) ..........................................................................................ERFRAPEALF Act_Schpo (10) ..........................................................................................ERFRAPEALF Act_Cryne (11) ..........................................................................................ERFRCPEALF Nucleotide Act1_Maize (12) ..........................................................................................ERFRCPEVLF Act3_Pea (13) ..........................................................................................ERFRCPEVTV Act1_Dauca (14) ..........................................................................................ERFRCPQVLF Act2_Dauca (15) ..........................................................................................RGSGCPEVLF Act2_Pea (16) ..........................................................................................ERFRCPEVLF Act3_Soybn (17) ..........................................................................................ERFRCPKILF Cation Act1_Acaca (18) ..........................................................................................ERFRAPEALF Actd_Phypo (19) ..........................................................................................ERFRCSEVLF Act4_Dicdi (20) ..........................................................................................ERFRCPEALF Act3_Dicdi (21) ..........................................................................................ERFRCPEALF Act_Enthi (22) ..........................................................................................ERFRCPEALF Act_Phyme (23) ..........................................................................................ERFRTPEVLF Act1_Naefo (24) ..........................................................................................ERFRCPEVLF Act1_Plafa (25) ..........................................................................................ERFRCPEALF Act2_Plafa (26) ..........................................................................................ERFRCPEALF Act_Leima (27) ..........................................................................................QRFRCPEVLF Act_Eupcr (28) ..........................................................................................QRFQCPEFLF Act1_Oxyno (29) ..........................................................................................ARFRCPEYLF Arp53D D mel ..........................................................................................ERFRCPEALF DNase Arp1 H sap a ..........................................................................................SRFRAPELLF Arp1 H sap b ..........................................................................................ARFRAPELLF Arp1 D mel ..........................................................................................ARFRAPEAVF Arp1 N cra ..........................................................................................ERFRAPEILF Arp1 P car ..........................................................................................ERFRAPEILF Arp1 S cer ..........................................................................................DRYRAPEILF Actin Arp2 D mel ..........................................................................................ERFEAPEALF Arp2 G gal ..........................................................................................ERFEAPEALF Arp2 A cas ..........................................................................................ERFEAPECMF Arp2 S cer ..........................................................................................ERFEAPECLF Arp2 C ele ..........................................................................................ERFEAPEILF Myosin Arp3 S pom ..........................................................................................ERFLAPEIFF Arp3 S cer ..........................................................................................ERFLAPEIFF Arp3 B tau ..........................................................................................ERFLGPEIFF Arp3 D mel ..........................................................................................ERFLGPEIFF Arp3 D dis ..........................................................................................ERFLGPELFF Arp3 A cas ..........................................................................................ERFLGPEIFF Profilin Arp4 S cer ..........................................................................................TRYGFAEELF Arp23D3 S pom ..........................................................................................ERFRISEILF Arp5 S cer AKEEEEKKLKEQQWRETDLNGWIKDKRLKLNKLIKRRKEKLKLRDEMKDRKSQVSQNRMKNLASLAEDNVKQGAKRNRHQATIDNDPNDTERIRVPEVIF Arp6 S cer ..........................................................................................ELFTIPETFF ArpX D mel ..........................................................................................ERFTVPELLF ArpX C ele ..........................................................................................ERFAIPEILF Arp7 S cer ..........................................................................................ECYQFAEYLF Arp8 S cer ..........................................................................................EVMLAPLALF Arp9 S cer ..........................................................................................KNVKNSDLEF Arp10 S cer ..........................................................................................SRIPLPGSLY     701 710 720 730 740 750 760 770 780 790 800 Position Sec Struct Acts_Human (1) QPSFIGM............................................................................................. Act4_drome (2) QPSFLGM............................................................................................. Acta_Limpo (3) QPSFLGM............................................................................................. Actb_Xenbo (4) QPSFLGM............................................................................................. Actm_Aplca (5) QPILLGM............................................................................................. Act1_Podca (6) QPAFLGM............................................................................................. Act3_Bommo (7) QPSFLGM............................................................................................. Domain -> Act_Yeast (8) HPSVLGL............................................................................................. Act_Thela (9) NPAVLGH............................................................................................. Act_Schpo (10) QPSALGL............................................................................................. Act_Cryne (11) QPSLLGL............................................................................................. Nucleotide Act1_Maize (12) QPSLVGM............................................................................................. Act3_Pea (13) QPSMIGM............................................................................................. Act1_Dauca (14) QPSMIGM............................................................................................. Act2_Dauca (15) QPSMIGM............................................................................................. Act2_Pea (16) QPSMIGM............................................................................................. Act3_Soybn (17) QPSMIEM............................................................................................. Cation Act1_Acaca (18) QPSFLGM............................................................................................. Actd_Phypo (19) QSCFLGM............................................................................................. Act4_Dicdi (20) QPSLLAM............................................................................................. Act3_Dicdi (21) QPSFLGM............................................................................................. Act_Enthi (22) QPSFLGM............................................................................................. Act_Phyme (23) KPSMIGR............................................................................................. Act1_Naefo (24) QPNFIGM............................................................................................. Act1_Plafa (25) QPSFLGK............................................................................................. Act2_Plafa (26) NPTLIGR............................................................................................. Act_Leima (27) KPSLIGL............................................................................................. Act_Eupcr (28) QPD.LGG............................................................................................. Act1_Oxyno (29) KPLEMNG............................................................................................. Arp53D D mel QPSLLGQ............................................................................................. DNase Arp1 H sap a RPDLIGE............................................................................................. Arp1 H sap b QPDLVGD............................................................................................. Arp1 D mel RPDLLGE............................................................................................. Arp1 N cra DPEIIGL............................................................................................. Arp1 P car DPEIIGS............................................................................................. Arp1 S cer SPQIIGL............................................................................................. Actin aaaa Arp2 D mel QPHLINV............................................................................................. Arp2 G gal QPHLINV............................................................................................. Arp2 A cas NPALVDQ............................................................................................. Arp2 S cer QPGLVDV............................................................................................. Arp2 C ele QPHLINV............................................................................................. Myosin Arp3 S pom NPEIASS............................................................................................. Arp3 S cer NPEIASS............................................................................................. Arp3 B tau HPEFANP............................................................................................. Arp3 D mel HPEFSNP............................................................................................. Arp3 D dis NPEIASS............................................................................................. Arp3 A cas NPEIFSS............................................................................................. Profilin Arp4 S cer LPKEDDIPANWPRSNSGVVKTWRNDYVPLKRTKPSGVNKSDKKVTPTEEKEQEAVSKSTSPAANSADTPNETGKRPLEEE...............KPPKE Arp23D3 S pom NPSFSASRSAETT......................................................................................P Arp5 S cer QPTMGGQ............................................................................................. Arp6 S cer HPEISQI............................................................................................. ArpX D mel NPSDIGV............................................................................................. ArpX C ele NPSDIDI............................................................................................. Arp7 S cer KPQLISD............................................................................................K Arp8 S cer FPQIFKLIRTSSHKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGNLYCDLNDDLKILNRILDYCDLNDDLKILNRILDAHNIIDQLQDKPENYGNTL Arp9 S cer NT.FWDE.....................................................................................KGNEIKVG Arp10 S cer MPIFFDEEYNSKNCEV....................................................................................     801 810 820 830 840 850 860 870 880 890 900 Position 274 282 288 297 Sec Struct hhhhhhhhh hhhhhhh bbbb Acts_Human (1) ..ESAGIHETTYNSIMK........................................CDIDIRKDLYANNVMSGGTTMYPG................... Act4_drome (2) ..ESCGIHETVYQSIMK........................................CDVDIRKDLYANNVLSGGTTMYPG................... Acta_Limpo (3) ..EACGIHETTFNSIMK........................................CDVDIRKDLYANTVLSGGSTMFPG................... Actb_Xenbo (4) ..ESCGIHETTFNSIMK........................................CDVDIRKDLYANTVLSGGTTMYPG................... Actm_Aplca (5) ..ESAGIHETTYNSIMK........................................CDVDIRKDLYANTVLSGGTTMFPG................... Act1_Podca (6) ..ESAGIHETTYNSIMK........................................CDVDIRKDLYANTVLSGGTTMFPG................... Act3_Bommo (7) ..EANGIHETTYNSIMK........................................CDVDIRKDLYANTVLSGGTTMYPG................... Domain <-------------------------------------- IIa or 3 ----------------------------------------------- Act_Yeast (8) ..ESAGIDQTTYNSIMK........................................CDVDVRKELYGNIVMSGGTTMFPG................... Act_Thela (9) ..ESGGIHETTFNSIIK........................................CDVDVRKDLYGNIVMSGGTTMYPG................... Act_Schpo (10) ..ENAGIHEATYNSIMK........................................CDVDIRKDLYGNVVMSGGTTMYPG................... Act_Cryne (11) ..EAAGIHETTYNSIMK........................................CDLDIRKDLYGNIVMSGGTTMYNG................... Nucleotide nn nn Act1_Maize (12) ..ESPSVHEATYNSIMK........................................CDVDIRKDLYGNVVLSGGFTMFPG................... Act3_Pea (13) ..ESPGIHETTFNSIMK........................................CDVDIRKDLYGNIVLSGGSTMFPG................... Act1_Dauca (14) ..ESAGIHETTYNSIMK........................................CDVDIRKDLYGNIVLSGGSTMFPG................... Act2_Dauca (15) ..ESAGIHETTYNSIMK........................................CDVDIRKDLYGNIVLSGGSTMFPGS.................. Act2_Pea (16) ..EAAGIHETTYNSIMK........................................CDVDIRKDLYGNIVLSGGTTMFPG................... Act3_Soybn (17) ..EAAGIHETTYNSIMK........................................CDVDIRKDLYGNIVLSGGSTMFLG................... Cation Act1_Acaca (18) ..ESAGIHETTYNSIMK........................................CDVDIRKDLYGNVVLSGGTTMFPG................... Actd_Phypo (19) ..ESAGIPETTYNSIMK........................................CDVDIRKDLFGNLVLSGGTTMVPG................... Act4_Dicdi (20) ..ESAGIHETIYNSIMK........................................CDVDIRRYLFGNVILSGGSTMFPG................... Act3_Dicdi (21) ..ESAGIHETTYNSIMK........................................CDVDIRKDLYSNVVLSGGSTMFPG................... Act_Enthi (22) ..ECNGIHETTYNSIMK........................................CDVDIRKDLYGNIVLSGGTSMYPG................... Act_Phyme (23) ..ECTGVHECAFQTIMK........................................CDVDIRRDLYNNVVLSGGSTMFPG................... Act1_Naefo (24) ..EAAGVHETTFNSIGK........................................CDIDIRKDLYGNVVLSGGTTMFEG................... Act1_Plafa (25) ..EAAGIHTTTFNSIKK........................................CDVDIRKDLYGNIVLSGGTTMYEG................... Act2_Plafa (26) ..ECPGLHITAYQSIMK........................................CDIDIRKELYNNIVLSGGTTMYNN................... Act_Leima (27) .DEAPGFPEMVYQSINK........................................CDIDVRRELYGNIVLSGGSTMFLN................... Act_Eupcr (28) .RECKSVHQLTYDSIMT........................................CDLDVRKDLYANIILSGGTTMFPG................... Act1_Oxyno (29) .KELDSIQSLTYNSIQE........................................CDVDVRRDLYQNITLSGGTTMYEG................... Arp53D D mel ..EVMGIHEATHHSITN........................................CDMDLRKDMYANIVLSGGTTMFRN................... DNase Arp1 H sap a ..ESEGIHEVLVFAIQK........................................SDMDLRRTLFSNIVLSGGSTLFKG................... Arp1 H sap b ..ESEGLHEVVAFAIHK........................................SDMDLRRTLFANIVLSGGSTLFKG................... Arp1 D mel ..ECEGIHDVLMYSIEK........................................SDMDLRKMLYQNIVLSGGSTLFKG................... Arp1 N cra ..EYPGVHQIVVDSINR........................................TDLDLRRDLYSNIVLSGGSTLTKG................... Arp1 P car ..EYSGIHQVVVDAISR........................................VDLDLRKSLFGNIVLSGGSTLTRG................... Arp1 S cer ..GYDGLSDMCMQSIWK........................................VDLDLRKPLLSSIILSGGTTTLKG................... Actin aaaa Arp2 D mel ..EGPGIAELAFNTIQA........................................ADIDIRPELYKHIVLSGGSTMYPG................... Arp2 G gal ..EGVGVAELLFNTIQA........................................ADIDTRSEFYKHIVLSGGSTMYPG................... Arp2 A cas ..ESVGVGELVFDCINK........................................ADIDTRAEFYNHIVLSGGSTMYPG................... Arp2 S cer ..EQPGVGELLFNTVQS........................................ADVDIRSSLYKAIVLSGGSSMYPG................... Arp2 C ele ..EKAGLSELLFGCIQA........................................SDIDTRLDFYKHIVLSGGTTMYPG................... Myosin Arp3 S pom .DFLTPLPELVDNVVQS........................................SPIDVRKGLYKNIVLSGGSTLFKN................... Arp3 S cer .DFLTPLPTVVDQTIQA........................................CPIDVRKGLYNNIVLSGGSTMFKD................... Arp3 B tau .DFTQPISEVVDEVIQN........................................CPIDVRRPLYKNIVLSGGSTMFRD................... Arp3 D mel .DFTIPLSEIVDNVIQN........................................CPIDVRRPLYNNIVLSGGSTMFKD................... Arp3 D dis .DYLTPLPKVVDDTIQS........................................CPIDCRRGLYKNIVLSGGSTMFKD................... Arp3 A cas .DFLTPLPKVVDETIQS........................................CPIDTRRGLYKNIVLSGGSTMFKD................... Profilin p ppp p Arp4 S cer NNELIGLADLVYSSIMS........................................SDVDLRATLAHNVVLTGGTSSIPG................... Arp23D3 S pom PQGSVGLHELVYQSILA........................................CDSELRSPLLNNIVVTGGTSLIPG................... Arp5 S cer ..DQAGICELSETILLK.................................KFGSQPGKLSQTSIDMVNNVLITGGNAKVPG................... Arp6 S cer ..TKPGIVEAILESLSM........................................LPEIVRPLMVGNIVCTGGNFNLPN................... ArpX D mel ..QQVGIPEAVADCLKA........................................CPWEAHRELLLNILIVGGSAQFPG................... ArpX C ele ..DQCGVAEAVIESICQ........................................CPEALRPALAENIIVIGGSSCFPG................... Arp7 S cer FSPEDGLGPLMAKSVKKAGASINSMKANTSTNPNGLGTSHINTNVGDNNSTASSSNISPEQVYSLLLTNVIITGSTSLIEG................... Arp8 S cer KENFAPLEKAIVQSIANASIT....................................ADVTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSS Arp9 S cer KQRFQGCNNLIKNISNRVGLTLDNI................................DDINKAKAVWENIIIVGGTTSISG................... Arp10 S cer ..DETPVINLVKNIVES........................................LPIDLRRPLRENIIIVNIEEAYET...................     901 910 920 930 940 950 960 970 980 990 1000 Position 309 320 328 338 348 Struct hhhhhhhhhhhh bbbb h--hhhhhhhhhh Acts_Human (1) .....IADRMQKEITALA......................PSTMKIKIIA.............................PPERKYS..VWIGGSILASL. Act4_drome (2) .....IADRMQKEITALA......................PSTMKIKIIA.............................PPERKYS..VWIGGSILASL. Acta_Limpo (3) .....IADRMQKEIGALA......................PSTMKIKIIA.............................PPERKYS..VWIGGSILASL. Actb_Xenbo (4) .....IADRMQKEITALA......................PSTMKIKIIA.............................PPERKYS..VWIGGSILALL. Actm_Aplca (5) .....IADRMQKEITSLA......................PSTMKIKIIA.............................PPERKYS..VWIGGSILASL. Act1_Podca (6) .....IADRMQKEISSLA......................PPTMKIKIIA.............................PPERKYS..VWIGGSILASL. Act3_Bommo (7) .....IADRMQKEITRLA......................PSTMKIKIIA.............................PPERKYS..VWIGGSILASL. Domain --------------------------------- IIa or 3 ------------------------------------><-------------- Act_Yeast (8) .....IAERMQKEITALA......................PSSMKVKIIA.............................PPERKYS..VWIGGSILASL. Act_Thela (9) .....IADRMQKELTALA......................PSSMKIKIIA.............................PPERKYS..VWIGGSILASL. Act_Schpo (10) .....IADRMQKEIQALA......................PSSMKVKIVA.............................PPERKYS..VWIGGSILASL. Act_Cryne (11) .....IADRMQKEITALA......................PSSMKVKIVS.............................PPERKYS..VWIGGSILASL. Nucleotide n Act1_Maize (12) .....IADRMSKEITSLV......................PSSMKVKVVA.............................PPRRKYS..VWIGGSILASL. Act3_Pea (13) .....IADRMSKEITALA......................PSSMKIKVVA.............................PPERKYS..VWIGGSILASL. Act1_Dauca (14) .....IADRMSKEITALA......................PSSMKIKVVA.............................PPERKYS.DLWIGGSILASL. Act2_Dauca (15) .....CYASMSKEITALA......................PSSMKIKVVA.............................PPERKYS..VWIGGSILASL. Act2_Pea (16) .....IADRMSKEITALA......................PSSMKIKVVA.............................PPERRYS..VWIGGSILASL. Act3_Soybn (17) .....IADRMSKEISALA......................PSSMKIKVVA.............................PPERKYS..VWIGGSILASL. Cation Act1_Acaca (18) .....IADRMQKELTALA......................PSTMKIKIIA.............................PPERKYS..VWIGGSILASL. Actd_Phypo (19) .....IADRVQKELTAFE.......................PTMKIKIIA.............................PPGRQYS..AWIGGSILASL. Act4_Dicdi (20) .....IADRMNKELTALA......................PSTMKIKIIA.............................PPERKYS..VWVGGSILASL. Act3_Dicdi (21) .....IADRMNKELTALA......................PSTMKIKIIA.............................PPERKYS..VWIGGSILASL. Act_Enthi (22) .....INTRLEKEMIQLA......................PPTMKIKVIA.............................PPERKYS..VWIGGSILASL. Act_Phyme (23) .....IGDRMTKEMTKLA......................PTAMKVKIIT.............................PPERKYS..VWIGGSILASL. Act1_Naefo (24) .....IAERMTKELTNMA......................PASMKIKVVA.............................PPERKYS..VWIGGSILASL. Act1_Plafa (25) .....TGERLTRDITTLA......................PSTMKIKVVA.............................PPERKYS..VWIGGSILSSL. Act2_Plafa (26) .....IGERLTKEMTNLA......................PSSMKIKVIA.............................PPERKYS..VWIGGSILSSL. Act_Leima (27) .....LPERLAKEISNLA......................PSSIKPKVVA.............................PPERKYS..VWIGGSILSSL. Act_Eupcr (28) .....LGERLYKEMKDLA......................PQTMKVKVIA.............................SPDRKYA..VWRGGSTLAKL. Act1_Oxyno (29) .....IGERLLKEIEARA......................PKSINVKVIA.............................SPDRRFA..VWRGGSTLTSL. Arp53D D mel .....IEHRFLQDLTEMA......................PPSIRIKVNA.............................SPDRRFS..VWTGGSVLASL. DNase Arp1 H sap a .....FGDRLLSEVKKLA......................PKDVKIRISA.............................PQERLYS..TWIGGSILASL. Arp1 H sap b .....FGDRLLSEVKKLA......................PKDIKIKISA.............................PQERLYS..TWIGGSILASL. Arp1 D mel .....FGDRLLSELKKHS......................AKDLKIRIAA.............................PQERLYS..TWMGGSILASL. Arp1 N cra .....FGDRLLTEVQKLA......................VKDMRIKIFA.............................PPERKYS..TWIGGSILAGL. Arp1 P car .....FGDRLLSEIRRLA......................VKDVKIKIFA.............................PPERKYS..TWIGGSILASL. Arp1 S cer .....FGDRMLWDLEALT......................KGTSKIKIIA.............................PSERKYT..TWIGGSILTGL. Actin aaaa Arp2 D mel .....LPSRLEREIKQLYLERVLKNDTEK...........LAKFKIRIED.............................PPRRKDM..VFIGGAVLAEVT Arp2 G gal .....LPSRLERELKQLYLERVLKGDVEK...........LSKFKIRIED.............................PPRRKHM..VFLGGAVLADIM Arp2 A cas .....LPSRLEKEIKRLYFERVAKGNKVS...........MQKFKCRIED.............................PPRRKHM..VFLGGAVLAEIM Arp2 S cer .....LPSRLEKELKQLWFSRVLHNDPSR...........LDKFKVRIED.............................PPRRKHM..VFIGGAVLASIM Arp2 C ele .....LPSRLEKELKQLYLDRVLHGNTDA...........FQKFKIRIEA.............................PPSRKHM..VFLGGAVLANLM Myosin m Arp3 S pom .....FGNRLQRDLKRIVDERIHRSEMLS...........GAKSGG..VDVNVIS........................HKRQRNA..VNFGGSLLAQT. Arp3 S cer .....FGRRLQRDLKSIVNNRIAQSELLS...........GTKSTG..VDVSVIS........................HRKQRNA..VWFGGSLLAQT. Arp3 B tau .....FGRRLQRDLKRTVDARLKLSEELS...........GGRLKPKPIDVQVIT........................HHMQRYA..VWFGGSMLAST. Arp3 D mel .....FGRRLQRDIKRSVDTRLRISENLS...........EGRIKPKPIDVQVIT........................HHMQRYA..VWFGGSMLAST. Arp3 D dis .....FGKRLQRDVKRSVDYRIKRSEELS...........GGKIKAVPLAVNVIS........................HNMQRYA..VWFGGSMLAST. Arp3 A cas .....FGKRLQRDIKRAVDYRIKRSEELS...........QGRIKSKAVDVKVIS........................HHMQRFA..VWFGGSMLAST. Profilin Arp4 S cer .....LSDRLMTELNKIL.....................PSLKFRILTTGH............................TIERQYQ..SWLGGSILTSL. Arp23D3 S pom .....LSERLQAEVQRLA.....................TGSRINVHTAE.............................TASATSN.AVWFGGSILASL. Arp5 S cer .....LKERIVKEFTGFL......................PTGTNITVNM.............................SSDPSLD..AWKGMAALARNE Arp6 S cer .....FAQRLAAELQRQL......................PTDWTCHVSV.............................PEGDCAL.FGWEVMSQFAKT. ArpX D mel .....FLPRLKRDLRALV......................PDDLEVSLICP............................EDPVRY...AWYGGKEVATS. ArpX C ele .....FRERLEREVRSML......................PAEYGLNVSNDV...........................INPQTH...SWHCGQELLTA. Arp7 S cer .....MEQRIIKELSIRF.....................PQYKLTTANQVF............................MMDRKIQ..GWLGALTMANL. Arp8 S cer ASFPQFYKKLTKEIKDLEGHYVNAPDK....TEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIF.PVSIIPPPRDMNPALI..IWKGASVLAQI. Arp9 S cer .....FKEALLGQLLKDHLIIEPEEEKSKREEEAKSVLPAATKKKSKFMTNSTAFVPTIEYVQCPTVIKLAKYPDYFPEWKKSGYSEIIFLGAQIVSK.. Arp10 S cer .....VIRNLFKLKMDT............................SKIQF.................................PKN..YWQAGSACAKIL     1001 1010 1020 1030 1040 1050 Position 350 355 359 365 Sec Struct hhhhh---h hhh-hhhh Acts_Human (1) STFQQ...MWITKQE.YDEAGPSIVHRKCF............................. Act4_drome (2) STFQQ...MWISKQE.YDESGPGIVHRKCF............................. Acta_Limpo (3) STFQQ...MWISKQE.YDESGPSIVHRKCF............................. Actb_Xenbo (4) STFQQ...MWISKQE.YDESGPSIVHRKCF............................. Actm_Aplca (5) STFQQ...MWISKQE.YDESGPSIVHRKCF............................. Act1_Podca (6) STFQQ...MWISKQE.YDESGPSIVHRKCF............................. Act3_Bommo (7) STFQQ...MWISKQE.YDESGPSIVHRKCF............................. Domain - Ia or 1 -----------------> Act_Yeast (8) TTFQQ...MWISKQE.YDESGPSIVHHKCF............................. Act_Thela (9) STFQQ...MWVSKQE.YDESGPSIVHRKCF............................. Act_Schpo (10) STFQQ...MWISKQE.YDESGPGIVYRKCF............................. Act_Cryne (11) STFQQ...MWIAKSE.YDESGPSIVHRKCF............................. Nucleotide Act1_Maize (12) STFQQ...MWISKGE.YDETGPGIVHMKCF............................. Act3_Pea (13) STFQQ...MWIAKAE.YDESGPSIVHRKCF............................. Act1_Dauca (14) STFQQ...MWISKGE.YDESGPSIVHRKCLLAG.......................... Act2_Dauca (15) STFQQ...MWISKGE.YDESGPSIVHRKCF............................. Act2_Pea (16) STFQQ...MWISKAE.YDERGPSIVHRKCF............................. Act3_Soybn (17) STFQQ...MWISKGE.YDESGPSIVHRKCF............................. Cation Act1_Acaca (18) STFQQ...MWISKEE.YDESGPSIVHRKCF............................. Actd_Phypo (19) STFEQ...MCISKKE.YNECGPSIVHRKCF............................. Act4_Dicdi (20) SSFQE...MWISKEE.YNESGPSIVHRKCSNYLK......................... Act3_Dicdi (21) STFQQ...MWISKEE.YDESGPSIVHRKCF............................. Act_Enthi (22) STFQN...MWITKEE.YDESGPAIVHRKCF............................. Act_Phyme (23) ATFQH...MWISKTD.YDESGPSIVHRKCF............................. Act1_Naefo (24) STFQQ...MWITKEE.YEDAGPGIVHRKSF............................. Act1_Plafa (25) STFQQ...MWITKEE.YDESGPSIVHRKCF............................. Act2_Plafa (26) STFQQ...MWITKEE.YEDSGPSIVHRKCF............................. Act_Leima (27) TTFQT...MWVKKSE.YDESGPSIVHNKCF............................. Act_Eupcr (28) STFAG...MWVTKED.YAEFGESIVHRKCI............................. Act1_Oxyno (29) STFAS...MWITKED.YDENGASIVHRKCL............................. Arp53D D mel TSFQN...MWIDSLE.YEEVGSAIVHRKCF............................. DNase Arp1 H sap a DTFKK...MWVSKKE.YEEDGARSIHRKTF............................. Arp1 H sap b DTFKK...MWVSKKE.YEEDGSRAIHRKTF............................. Arp1 D mel DTFKK...MWISKRE.YEEEGQKAVHRKTF............................. Arp1 N cra STFRK...MWVSIDD.WHENPD.IIHTKFT............................. Arp1 P car STFRK...MWVSAEE.YQEDPD.IIHRKSI............................. Arp1 S cer STFQR...LWTKKSD.WLEDSTRVYS.NLM............................. Actin a Arp2 D mel KDRDG...FWMSKQE.YQEQGLKVLQKLQKISH.......................... Arp2 G gal KDKDN...FWMTRQE.YQEKGVRVLEKLGVTVR.......................... Arp2 A cas KDKTA...FWMNKSE.YEEQGPRVLR.KCF............................. Arp2 S cer ADKDH...MWLSKQE.WQESGPSAMTKFGPR............................ Arp2 C ele KDRDQ..DFWVSKKE.YEEGGIARCMAKLGIKA.......................... Myosin Arp3 S pom PEFGS...YCHTKAD.YEEYGASIARRYQIFGNSL........................ Arp3 S cer AEFKG...YCHTKKD.YEEYGPEIVRNFSLFNMV......................... Arp3 B tau PEFYQ...VCHTKKD.YEEIGPSICRHNPVFGVMS........................ Arp3 D mel PEFYQ...VCHTKAA.YEEYGPSICRHNPVFGTMT........................ Arp3 D dis PEFYN...VCHTKAQ.YDEIGPSICRFNTVIGGIN........................ Arp3 A cas PEFYK...VCHTKQQ.YDEVGPSICRHNPVFGAMTM....................... Profilin p p p p p ppp p Arp4 S cer GTFHQ...LWVGKKE.YEEVGVERLLNDRFR............................ Arp23D3 S pom DNFQH...LWVSKQE.YDEVGVDRALFVEKRCK.......................... Arp5 S cer EQYRK...TVISKKE.YEEYGPEYIKEHKLGNTKYFED..................... Arp6 S cer DSYRK...ARVTREE.YYEHGPDWCTKHRFGYQNWI....................... ArpX D mel PNFEE...FVYTQDD.YEEYGFQGINQR............................... ArpX C ele SKV.....PWINRKD.WDERGDSLEFSNFFQTLVQSDELKGTRNFDDQREKSPKEDEDF Arp7 S cer PSWSLG..KWYSKED.YETLKRDRKQSQATNATN......................... Arp8 S cer KLVEE...LFITNSD.WDVHGSRILQYKCIFTY.......................... Arp9 S cer QIFTHPKDTFYITREKYNMKGPAALWDVQF............................. Arp10 S cer LHYKGSNIVGIERDEFYNNPHIAPDWFDYYFRTGVKRLQ....................